PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB_related
Protein Properties Length: 262aa    MW: 29133.8 Da    PI: 6.5042
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010967genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.41.1e-10107146444
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      W ++++ ll+++++++G  +W+ +a+++g +++ +qc++++
        Cla010967 107 WNADDEILLLEGIEMYGFWNWAEVAEHVG-TKSKEQCIEHY 146
                      *****************************.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002913.3E-114387IPR000433Zinc finger, ZZ-type
PfamPF005691.2E-94586IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.7674790IPR000433Zinc finger, ZZ-type
SuperFamilySSF578502.59E-1447110No hitNo description
CDDcd023351.13E-254795No hitNo description
PROSITE patternPS0135704976IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.96E-1299153IPR009057Homeodomain-like
PROSITE profilePS5129320.295102154IPR017884SANT domain
SMARTSM007173.1E-9103152IPR001005SANT/Myb domain
PfamPF002492.0E-10106146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-7107147IPR009057Homeodomain-like
CDDcd001673.67E-11107146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRSRGNFQS DEDPTQRSRR KKNSSSGDNL ESTTPGQGTT EGKKALYHCN YCIKDITGKI  60
RIKCAMCPDF DLCIECFSVG AELTPHKSNH PYRVMDNLSF PLICPDWNAD DEILLLEGIE  120
MYGFWNWAEV AEHVGTKSKE QCIEHYSCVY MNSPYFPLPD MSHVVGKNRK ELLAMAKGHG  180
EDKKGFSMLG ELNLKEESPF SPSRVKVEDT HKVDPSGRLS SSSTSEEGSF NMATATANKK  240
ASSANQVKDG LVKVEGLVQI YS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819303e-89LN681930.1 Cucumis melo genomic scaffold, anchoredscaffold00087.
GenBankLN7132663e-89LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139515.10.0PREDICTED: transcriptional adapter ADA2b
SwissprotQ9ATB41e-111TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A0A0LSZ80.0A0A0A0LSZ8_CUCSA; Uncharacterized protein
STRINGVIT_00s0194g00130.t011e-148(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726